Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups


  1. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,863
  2. Avatar for Team South Africa 13. Team South Africa 1 pt. 6,608
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 5,702
  4. Avatar for Deleted group 15. Deleted group pts. 5,627

  1. Avatar for franzemanz 101. franzemanz Lv 1 1 pt. 8,335
  2. Avatar for Ciocie053 102. Ciocie053 Lv 1 1 pt. 8,320
  3. Avatar for multaq 103. multaq Lv 1 1 pt. 8,280
  4. Avatar for Knoblerine 104. Knoblerine Lv 1 1 pt. 8,101
  5. Avatar for larry25427 105. larry25427 Lv 1 1 pt. 8,061
  6. Avatar for carsonfb 106. carsonfb Lv 1 1 pt. 8,057
  7. Avatar for Gahmeir 107. Gahmeir Lv 1 1 pt. 8,014
  8. Avatar for Anamfija 108. Anamfija Lv 1 1 pt. 7,837
  9. Avatar for Louis_LIB 109. Louis_LIB Lv 1 1 pt. 7,836
  10. Avatar for InfoManiac742 110. InfoManiac742 Lv 1 1 pt. 7,587

Comments