Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups


  1. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,863
  2. Avatar for Team South Africa 13. Team South Africa 1 pt. 6,608
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 5,702
  4. Avatar for Deleted group 15. Deleted group pts. 5,627

  1. Avatar for rezaefar 111. rezaefar Lv 1 1 pt. 7,542
  2. Avatar for Interloper 112. Interloper Lv 1 1 pt. 7,468
  3. Avatar for Eron333 113. Eron333 Lv 1 1 pt. 7,316
  4. Avatar for Tehnologik1 114. Tehnologik1 Lv 1 1 pt. 7,083
  5. Avatar for anaserra 115. anaserra Lv 1 1 pt. 7,076
  6. Avatar for moralmar00 116. moralmar00 Lv 1 1 pt. 7,018
  7. Avatar for 01010011111 117. 01010011111 Lv 1 1 pt. 6,860
  8. Avatar for Realm999 118. Realm999 Lv 1 1 pt. 6,774
  9. Avatar for doctaven 119. doctaven Lv 1 1 pt. 6,608
  10. Avatar for retiredmichael 120. retiredmichael Lv 1 1 pt. 6,508

Comments