Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,123
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,863
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 6,608
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 5,702
  5. Avatar for Deleted group 15. Deleted group pts. 5,627
  1. Avatar for ivalnic 121. ivalnic Lv 1 1 pt. 6,459
  2. Avatar for cherry39 122. cherry39 Lv 1 1 pt. 6,245
  3. Avatar for antibot215 123. antibot215 Lv 1 1 pt. 6,220
  4. Avatar for aspadistra 124. aspadistra Lv 1 1 pt. 5,702
  5. Avatar for fwadwani 125. fwadwani Lv 1 1 pt. 5,627
  6. Avatar for henrykimball 126. henrykimball Lv 1 1 pt. 5,496
  7. Avatar for BillNye769 127. BillNye769 Lv 1 1 pt. 2,896
  8. Avatar for phi16 128. phi16 Lv 1 1 pt. 379
  9. Avatar for Aryo 129. Aryo Lv 1 1 pt. 0
  10. Avatar for lamoille 130. lamoille Lv 1 1 pt. 0

Comments