Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,123
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,863
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 6,608
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 5,702
  5. Avatar for Deleted group 15. Deleted group pts. 5,627
  1. Avatar for YGK 61. YGK Lv 1 5 pts. 9,687
  2. Avatar for MicElephant 62. MicElephant Lv 1 5 pts. 9,683
  3. Avatar for JasperD 63. JasperD Lv 1 5 pts. 9,622
  4. Avatar for Flagg65a 64. Flagg65a Lv 1 5 pts. 9,615
  5. Avatar for pfirth 65. pfirth Lv 1 4 pts. 9,610
  6. Avatar for cbwest 66. cbwest Lv 1 4 pts. 9,589
  7. Avatar for navn 67. navn Lv 1 4 pts. 9,572
  8. Avatar for pfeiffelfloyd 68. pfeiffelfloyd Lv 1 4 pts. 9,538
  9. Avatar for froggs554 69. froggs554 Lv 1 3 pts. 9,516
  10. Avatar for DoctorSockrates 70. DoctorSockrates Lv 1 3 pts. 9,500

Comments