Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups


  1. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,863
  2. Avatar for Team South Africa 13. Team South Africa 1 pt. 6,608
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 5,702
  4. Avatar for Deleted group 15. Deleted group pts. 5,627

  1. Avatar for ManVsYard 81. ManVsYard Lv 1 2 pts. 9,155
  2. Avatar for Jesse Pinkman 82. Jesse Pinkman Lv 1 1 pt. 9,144
  3. Avatar for yoyoparis 83. yoyoparis Lv 1 1 pt. 9,131
  4. Avatar for kludbrook 84. kludbrook Lv 1 1 pt. 9,127
  5. Avatar for nathanmills 85. nathanmills Lv 1 1 pt. 9,123
  6. Avatar for Superphosphate 86. Superphosphate Lv 1 1 pt. 9,099
  7. Avatar for rabamino12358 87. rabamino12358 Lv 1 1 pt. 9,098
  8. Avatar for JMStiffler 88. JMStiffler Lv 1 1 pt. 9,088
  9. Avatar for ViJay7019 89. ViJay7019 Lv 1 1 pt. 9,041
  10. Avatar for Arne Heessels 90. Arne Heessels Lv 1 1 pt. 8,969

Comments