Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,885
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  5. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  6. Avatar for freefolder 16. freefolder 1 pt. 9,541
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,502
  1. Avatar for scotths 91. scotths Lv 1 1 pt. 9,891
  2. Avatar for nathanmills 92. nathanmills Lv 1 1 pt. 9,885
  3. Avatar for Arne Heessels 93. Arne Heessels Lv 1 1 pt. 9,876
  4. Avatar for aspadistra 94. aspadistra Lv 1 1 pt. 9,867
  5. Avatar for SouperGenious 95. SouperGenious Lv 1 1 pt. 9,867
  6. Avatar for chieltbest 96. chieltbest Lv 1 1 pt. 9,851
  7. Avatar for rabamino12358 97. rabamino12358 Lv 1 1 pt. 9,849
  8. Avatar for TedStudley 98. TedStudley Lv 1 1 pt. 9,845
  9. Avatar for rinze 99. rinze Lv 1 1 pt. 9,838
  10. Avatar for pfirth 100. pfirth Lv 1 1 pt. 9,837

Comments