Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  4. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  5. Avatar for freefolder 16. freefolder 1 pt. 9,541
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531

  1. Avatar for crpainter 11. crpainter Lv 1 70 pts. 10,719
  2. Avatar for dam_01 12. dam_01 Lv 1 67 pts. 10,715
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 65 pts. 10,715
  4. Avatar for frood66 14. frood66 Lv 1 62 pts. 10,693
  5. Avatar for YeshuaLives 15. YeshuaLives Lv 1 60 pts. 10,692
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 57 pts. 10,690
  7. Avatar for tarimo 17. tarimo Lv 1 55 pts. 10,674
  8. Avatar for LociOiling 18. LociOiling Lv 1 53 pts. 10,666
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 51 pts. 10,651
  10. Avatar for O Seki To 20. O Seki To Lv 1 49 pts. 10,627

Comments