Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,885
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  5. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  6. Avatar for freefolder 16. freefolder 1 pt. 9,541
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,502
  1. Avatar for smilingone 31. smilingone Lv 1 31 pts. 10,563
  2. Avatar for eusair 32. eusair Lv 1 29 pts. 10,558
  3. Avatar for jausmh 33. jausmh Lv 1 28 pts. 10,554
  4. Avatar for Idiotboy 34. Idiotboy Lv 1 27 pts. 10,546
  5. Avatar for Glen B 35. Glen B Lv 1 26 pts. 10,535
  6. Avatar for Deleted player 36. Deleted player pts. 10,527
  7. Avatar for khalan.ysatis 37. khalan.ysatis Lv 1 23 pts. 10,524
  8. Avatar for pvc78 38. pvc78 Lv 1 22 pts. 10,516
  9. Avatar for weitzen 39. weitzen Lv 1 21 pts. 10,505
  10. Avatar for ReallyRatherDumb 40. ReallyRatherDumb Lv 1 20 pts. 10,499

Comments