Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,885
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  5. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  6. Avatar for freefolder 16. freefolder 1 pt. 9,541
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,502
  1. Avatar for carsonfb 41. carsonfb Lv 1 19 pts. 10,496
  2. Avatar for cbwest 42. cbwest Lv 1 18 pts. 10,490
  3. Avatar for toshiue 43. toshiue Lv 1 18 pts. 10,481
  4. Avatar for actiasluna 44. actiasluna Lv 1 17 pts. 10,468
  5. Avatar for DoctorSockrates 45. DoctorSockrates Lv 1 16 pts. 10,462
  6. Avatar for guineapig 46. guineapig Lv 1 15 pts. 10,430
  7. Avatar for diamonddays 47. diamonddays Lv 1 14 pts. 10,427
  8. Avatar for Norrjane 48. Norrjane Lv 1 14 pts. 10,413
  9. Avatar for Anfinsen_slept_here 49. Anfinsen_slept_here Lv 1 13 pts. 10,408
  10. Avatar for joremen 50. joremen Lv 1 12 pts. 10,388

Comments