Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,885
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  5. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  6. Avatar for freefolder 16. freefolder 1 pt. 9,541
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,502
  1. Avatar for cobaltteal 51. cobaltteal Lv 1 12 pts. 10,387
  2. Avatar for NinjaGreg 52. NinjaGreg Lv 1 11 pts. 10,386
  3. Avatar for frostschutz 53. frostschutz Lv 1 11 pts. 10,376
  4. Avatar for rezaefar 54. rezaefar Lv 1 10 pts. 10,363
  5. Avatar for Crossed Sticks 55. Crossed Sticks Lv 1 9 pts. 10,340
  6. Avatar for Deleted player 56. Deleted player pts. 10,329
  7. Avatar for Vinara 57. Vinara Lv 1 8 pts. 10,321
  8. Avatar for alwen 58. alwen Lv 1 8 pts. 10,317
  9. Avatar for stomjoh 59. stomjoh Lv 1 8 pts. 10,314
  10. Avatar for sciencewalker 60. sciencewalker Lv 1 7 pts. 10,314

Comments