Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  4. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  5. Avatar for freefolder 16. freefolder 1 pt. 9,541
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531

  1. Avatar for alyssa_d 61. alyssa_d Lv 1 7 pts. 10,302
  2. Avatar for silent gene 62. silent gene Lv 1 6 pts. 10,292
  3. Avatar for alcor29 63. alcor29 Lv 1 6 pts. 10,270
  4. Avatar for manu8170 64. manu8170 Lv 1 6 pts. 10,268
  5. Avatar for isaksson 65. isaksson Lv 1 5 pts. 10,252
  6. Avatar for ourtown 66. ourtown Lv 1 5 pts. 10,243
  7. Avatar for Vincera 67. Vincera Lv 1 5 pts. 10,218
  8. Avatar for mitarcher 68. mitarcher Lv 1 4 pts. 10,211
  9. Avatar for jobo0502 69. jobo0502 Lv 1 4 pts. 10,210
  10. Avatar for joaniegirl 70. joaniegirl Lv 1 4 pts. 10,157

Comments