Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,216
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 11,182
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,175
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 11,171
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 11,155
  6. Avatar for Go Science 6. Go Science 16 pts. 11,108
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,090
  8. Avatar for Contenders 8. Contenders 6 pts. 11,063
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,060
  10. Avatar for Cannabis Crew 10. Cannabis Crew 2 pts. 10,595
  1. Avatar for altejoh 31. altejoh Lv 1 32 pts. 10,848
  2. Avatar for pvc78 32. pvc78 Lv 1 30 pts. 10,836
  3. Avatar for Idiotboy 33. Idiotboy Lv 1 29 pts. 10,800
  4. Avatar for Glen B 34. Glen B Lv 1 28 pts. 10,784
  5. Avatar for manu8170 35. manu8170 Lv 1 27 pts. 10,778
  6. Avatar for alwen 36. alwen Lv 1 25 pts. 10,777
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 24 pts. 10,770
  8. Avatar for Vinara 38. Vinara Lv 1 23 pts. 10,731
  9. Avatar for tarimo 39. tarimo Lv 1 22 pts. 10,717
  10. Avatar for gdnskye 40. gdnskye Lv 1 21 pts. 10,703

Comments