Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983
  1. Avatar for Altercomp 71. Altercomp Lv 1 4 pts. 10,335
  2. Avatar for Museka 72. Museka Lv 1 4 pts. 10,333
  3. Avatar for hada 73. hada Lv 1 4 pts. 10,329
  4. Avatar for boondog 74. boondog Lv 1 3 pts. 10,317
  5. Avatar for peanutbutterwithhoney 75. peanutbutterwithhoney Lv 1 3 pts. 10,305
  6. Avatar for Anfinsen_slept_here 76. Anfinsen_slept_here Lv 1 3 pts. 10,294
  7. Avatar for JasperD 77. JasperD Lv 1 3 pts. 10,271
  8. Avatar for rezaefar 78. rezaefar Lv 1 3 pts. 10,263
  9. Avatar for diamonddays 79. diamonddays Lv 1 3 pts. 10,242
  10. Avatar for Tubby 80. Tubby Lv 1 2 pts. 10,230

Comments