Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,216
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 11,182
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,175
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 11,171
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 11,155
  6. Avatar for Go Science 6. Go Science 16 pts. 11,108
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,090
  8. Avatar for Contenders 8. Contenders 6 pts. 11,063
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,060
  10. Avatar for Cannabis Crew 10. Cannabis Crew 2 pts. 10,595
  1. Avatar for Altercomp 71. Altercomp Lv 1 4 pts. 10,335
  2. Avatar for Museka 72. Museka Lv 1 4 pts. 10,333
  3. Avatar for hada 73. hada Lv 1 4 pts. 10,329
  4. Avatar for boondog 74. boondog Lv 1 3 pts. 10,317
  5. Avatar for peanutbutterwithhoney 75. peanutbutterwithhoney Lv 1 3 pts. 10,305
  6. Avatar for Anfinsen_slept_here 76. Anfinsen_slept_here Lv 1 3 pts. 10,294
  7. Avatar for JasperD 77. JasperD Lv 1 3 pts. 10,271
  8. Avatar for rezaefar 78. rezaefar Lv 1 3 pts. 10,263
  9. Avatar for diamonddays 79. diamonddays Lv 1 3 pts. 10,242
  10. Avatar for Tubby 80. Tubby Lv 1 2 pts. 10,230

Comments