Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since over 7 years ago

Intermediate Pilot

Summary

Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,660
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,652
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,621
  4. Avatar for Go Science 4. Go Science 30 pts. 11,619
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,619
  6. Avatar for Contenders 6. Contenders 11 pts. 11,527
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,510
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,435
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 11,230
  10. Avatar for Minions of TWIS 10. Minions of TWIS 1 pt. 11,126
  1. Avatar for Glen B 21. Glen B Lv 1 44 pts. 11,437
  2. Avatar for frood66 22. frood66 Lv 1 42 pts. 11,435
  3. Avatar for Crossed Sticks 23. Crossed Sticks Lv 1 40 pts. 11,424
  4. Avatar for nicobul 24. nicobul Lv 1 38 pts. 11,391
  5. Avatar for diamonddays 25. diamonddays Lv 1 36 pts. 11,372
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 35 pts. 11,366
  7. Avatar for tyler0911 27. tyler0911 Lv 1 33 pts. 11,356
  8. Avatar for phi16 28. phi16 Lv 1 31 pts. 11,337
  9. Avatar for joaniegirl 29. joaniegirl Lv 1 30 pts. 11,299
  10. Avatar for guineapig 30. guineapig Lv 1 28 pts. 11,252

Comments