Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since over 7 years ago

Intermediate Pilot

Summary


Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Beta Folders 100 pts. 11,660
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,652
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,621
  4. Avatar for Go Science 4. Go Science 30 pts. 11,619
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,619
  6. Avatar for Contenders 6. Contenders 11 pts. 11,527
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,510
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,435
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 11,230
  10. Avatar for Minions of TWIS 10. Minions of TWIS 1 pt. 11,126

  1. Avatar for stomjoh 51. stomjoh Lv 1 9 pts. 10,956
  2. Avatar for silent gene 52. silent gene Lv 1 9 pts. 10,940
  3. Avatar for Jesse Pinkman 53. Jesse Pinkman Lv 1 8 pts. 10,917
  4. Avatar for manu8170 54. manu8170 Lv 1 8 pts. 10,865
  5. Avatar for smilingone 55. smilingone Lv 1 7 pts. 10,855
  6. Avatar for isaksson 56. isaksson Lv 1 7 pts. 10,805
  7. Avatar for hexidecimalhack 57. hexidecimalhack Lv 1 6 pts. 10,783
  8. Avatar for SouperGenious 58. SouperGenious Lv 1 6 pts. 10,781
  9. Avatar for drumpeter18yrs9yrs 59. drumpeter18yrs9yrs Lv 1 6 pts. 10,759
  10. Avatar for weitzen 60. weitzen Lv 1 5 pts. 10,729

Comments