Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since over 7 years ago

Intermediate Pilot

Summary


Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Beta Folders 100 pts. 11,660
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,652
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,621
  4. Avatar for Go Science 4. Go Science 30 pts. 11,619
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,619
  6. Avatar for Contenders 6. Contenders 11 pts. 11,527
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,510
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,435
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 11,230
  10. Avatar for Minions of TWIS 10. Minions of TWIS 1 pt. 11,126

  1. Avatar for crpainter 31. crpainter Lv 1 27 pts. 11,247
  2. Avatar for actiasluna 32. actiasluna Lv 1 26 pts. 11,230
  3. Avatar for ReallyRatherDumb 33. ReallyRatherDumb Lv 1 25 pts. 11,206
  4. Avatar for Flagg65a 34. Flagg65a Lv 1 23 pts. 11,190
  5. Avatar for Anfinsen_slept_here 35. Anfinsen_slept_here Lv 1 22 pts. 11,165
  6. Avatar for gldisater 36. gldisater Lv 1 21 pts. 11,126
  7. Avatar for georg137 37. georg137 Lv 1 20 pts. 11,124
  8. Avatar for sciencewalker 38. sciencewalker Lv 1 19 pts. 11,117
  9. Avatar for NinjaGreg 39. NinjaGreg Lv 1 18 pts. 11,114
  10. Avatar for johnmitch 40. johnmitch Lv 1 17 pts. 11,112

Comments