Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups



  1. Avatar for Crossed Sticks 21. Crossed Sticks Lv 1 37 pts. 10,251
  2. Avatar for guineapig 22. guineapig Lv 1 35 pts. 10,247
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 33 pts. 10,229
  4. Avatar for dbuske 24. dbuske Lv 1 31 pts. 10,229
  5. Avatar for Flagg65a 25. Flagg65a Lv 1 29 pts. 10,206
  6. Avatar for crpainter 26. crpainter Lv 1 28 pts. 10,157
  7. Avatar for Blipperman 27. Blipperman Lv 1 26 pts. 10,143
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 25 pts. 10,114
  9. Avatar for georg137 29. georg137 Lv 1 23 pts. 10,085
  10. Avatar for MicElephant 30. MicElephant Lv 1 22 pts. 10,080

Comments