Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,889
  2. Avatar for Marvin's bunch 2. Marvin's bunch 63 pts. 10,766
  3. Avatar for Go Science 3. Go Science 37 pts. 10,738
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 10,638
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 10,635
  6. Avatar for Contenders 6. Contenders 5 pts. 10,359
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,143
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 1 pt. 9,992
  9. Avatar for freefolder 9. freefolder 1 pt. 9,380
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,262
  1. Avatar for Crossed Sticks 21. Crossed Sticks Lv 1 37 pts. 10,251
  2. Avatar for guineapig 22. guineapig Lv 1 35 pts. 10,247
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 33 pts. 10,229
  4. Avatar for dbuske 24. dbuske Lv 1 31 pts. 10,229
  5. Avatar for Flagg65a 25. Flagg65a Lv 1 29 pts. 10,206
  6. Avatar for crpainter 26. crpainter Lv 1 28 pts. 10,157
  7. Avatar for Blipperman 27. Blipperman Lv 1 26 pts. 10,143
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 25 pts. 10,114
  9. Avatar for georg137 29. georg137 Lv 1 23 pts. 10,085
  10. Avatar for MicElephant 30. MicElephant Lv 1 22 pts. 10,080

Comments