1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin
Closed since over 7 years ago
Intermediate Overall PredictionSummary
- Created
- July 16, 2018
- Expires
- Max points
- 100
This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
Top groups
Comments