Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Stuyvesant Molecular Science 2017-18 11. Stuyvesant Molecular Science 2017-18 1 pt. 8,840
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,603
  1. Avatar for stomjoh 31. stomjoh Lv 1 20 pts. 9,993
  2. Avatar for Museka 32. Museka Lv 1 19 pts. 9,992
  3. Avatar for dcrwheeler 33. dcrwheeler Lv 1 18 pts. 9,986
  4. Avatar for cobaltteal 34. cobaltteal Lv 1 17 pts. 9,967
  5. Avatar for NinjaGreg 35. NinjaGreg Lv 1 16 pts. 9,960
  6. Avatar for YeshuaLives 36. YeshuaLives Lv 1 15 pts. 9,957
  7. Avatar for Deleted player 37. Deleted player pts. 9,950
  8. Avatar for TastyMunchies 38. TastyMunchies Lv 1 13 pts. 9,900
  9. Avatar for DoctorSockrates 39. DoctorSockrates Lv 1 12 pts. 9,897
  10. Avatar for isaksson 40. isaksson Lv 1 11 pts. 9,835

Comments