Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,889
  2. Avatar for Marvin's bunch 2. Marvin's bunch 63 pts. 10,766
  3. Avatar for Go Science 3. Go Science 37 pts. 10,738
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 10,638
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 10,635
  6. Avatar for Contenders 6. Contenders 5 pts. 10,359
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,143
  8. Avatar for freefolder 9. freefolder 1 pt. 9,380
  9. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,262

  1. Avatar for stomjoh 31. stomjoh Lv 1 20 pts. 9,993
  2. Avatar for Museka 32. Museka Lv 1 19 pts. 9,992
  3. Avatar for dcrwheeler 33. dcrwheeler Lv 1 18 pts. 9,986
  4. Avatar for cobaltteal 34. cobaltteal Lv 1 17 pts. 9,967
  5. Avatar for NinjaGreg 35. NinjaGreg Lv 1 16 pts. 9,960
  6. Avatar for YeshuaLives 36. YeshuaLives Lv 1 15 pts. 9,957
  7. Avatar for Deleted player 37. Deleted player pts. 9,950
  8. Avatar for TastyMunchies 38. TastyMunchies Lv 1 13 pts. 9,900
  9. Avatar for DoctorSockrates 39. DoctorSockrates Lv 1 12 pts. 9,897
  10. Avatar for isaksson 40. isaksson Lv 1 11 pts. 9,835

Comments