Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,889
  2. Avatar for Marvin's bunch 2. Marvin's bunch 63 pts. 10,766
  3. Avatar for Go Science 3. Go Science 37 pts. 10,738
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 10,638
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 10,635
  6. Avatar for Contenders 6. Contenders 5 pts. 10,359
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,143
  8. Avatar for freefolder 9. freefolder 1 pt. 9,380
  9. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,262

  1. Avatar for Deleted player 71. Deleted player pts. 9,059
  2. Avatar for Superphosphate 72. Superphosphate Lv 1 1 pt. 9,055
  3. Avatar for lamoille 73. lamoille Lv 1 1 pt. 9,051
  4. Avatar for Auntecedent 74. Auntecedent Lv 1 1 pt. 9,045
  5. Avatar for korinnac 75. korinnac Lv 1 1 pt. 9,027
  6. Avatar for Bohan 76. Bohan Lv 1 1 pt. 9,020
  7. Avatar for momadoc 77. momadoc Lv 1 1 pt. 8,989
  8. Avatar for Anamfija 78. Anamfija Lv 1 1 pt. 8,961
  9. Avatar for weitzen 79. weitzen Lv 1 1 pt. 8,960
  10. Avatar for NotJim99 80. NotJim99 Lv 1 1 pt. 8,954

Comments