Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,889
  2. Avatar for Marvin's bunch 2. Marvin's bunch 63 pts. 10,766
  3. Avatar for Go Science 3. Go Science 37 pts. 10,738
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 10,638
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 10,635
  6. Avatar for Contenders 6. Contenders 5 pts. 10,359
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,143
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 1 pt. 9,992
  9. Avatar for freefolder 9. freefolder 1 pt. 9,380
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,262
  1. Avatar for rezaefar 51. rezaefar Lv 1 5 pts. 9,432
  2. Avatar for SouperGenious 52. SouperGenious Lv 1 5 pts. 9,415
  3. Avatar for Merf 53. Merf Lv 1 4 pts. 9,398
  4. Avatar for jausmh 54. jausmh Lv 1 4 pts. 9,394
  5. Avatar for Altercomp 55. Altercomp Lv 1 4 pts. 9,380
  6. Avatar for mitarcher 56. mitarcher Lv 1 3 pts. 9,359
  7. Avatar for sciencewalker 57. sciencewalker Lv 1 3 pts. 9,349
  8. Avatar for fpc 58. fpc Lv 1 3 pts. 9,336
  9. Avatar for jobo0502 59. jobo0502 Lv 1 3 pts. 9,286
  10. Avatar for Vincera 60. Vincera Lv 1 3 pts. 9,283

Comments