Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups



  1. Avatar for rezaefar 101. rezaefar Lv 1 1 pt. 9,150
  2. Avatar for kludbrook 102. kludbrook Lv 1 1 pt. 8,826
  3. Avatar for ourtown 103. ourtown Lv 1 1 pt. 8,708
  4. Avatar for 181818 104. 181818 Lv 1 1 pt. 8,141
  5. Avatar for kvasirthewise 105. kvasirthewise Lv 1 1 pt. 7,507
  6. Avatar for Lendsheep 106. Lendsheep Lv 1 1 pt. 7,374
  7. Avatar for Anamfija 107. Anamfija Lv 1 1 pt. 7,283
  8. Avatar for antibot215 108. antibot215 Lv 1 1 pt. 7,281
  9. Avatar for alyssajoyh 109. alyssajoyh Lv 1 1 pt. 6,766
  10. Avatar for sboy171772 110. sboy171772 Lv 1 1 pt. 6,292

Comments