Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,503
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,427
  3. Avatar for Contenders 3. Contenders 37 pts. 11,392
  4. Avatar for Gargleblasters 4. Gargleblasters 21 pts. 11,366
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 11,350
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 11,318
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,305
  8. Avatar for Go Science 8. Go Science 1 pt. 11,247
  9. Avatar for freefolder 9. freefolder 1 pt. 11,069
  10. Avatar for Stuyvesant Molecular Science 2017-18 10. Stuyvesant Molecular Science 2017-18 1 pt. 9,435
  1. Avatar for rezaefar 101. rezaefar Lv 1 1 pt. 9,150
  2. Avatar for kludbrook 102. kludbrook Lv 1 1 pt. 8,826
  3. Avatar for ourtown 103. ourtown Lv 1 1 pt. 8,708
  4. Avatar for 181818 104. 181818 Lv 1 1 pt. 8,141
  5. Avatar for kvasirthewise 105. kvasirthewise Lv 1 1 pt. 7,507
  6. Avatar for Lendsheep 106. Lendsheep Lv 1 1 pt. 7,374
  7. Avatar for Anamfija 107. Anamfija Lv 1 1 pt. 7,283
  8. Avatar for antibot215 108. antibot215 Lv 1 1 pt. 7,281
  9. Avatar for alyssajoyh 109. alyssajoyh Lv 1 1 pt. 6,766
  10. Avatar for sboy171772 110. sboy171772 Lv 1 1 pt. 6,292

Comments