Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Team Schleswig-Holstein 11. Team Schleswig-Holstein 1 pt. 172
  2. Avatar for test_group1 12. test_group1 1 pt. 0
  1. Avatar for pfirth 71. pfirth Lv 1 2 pts. 10,710
  2. Avatar for Knoblerine 72. Knoblerine Lv 1 2 pts. 10,680
  3. Avatar for AtOneMent 73. AtOneMent Lv 1 2 pts. 10,639
  4. Avatar for Superphosphate 74. Superphosphate Lv 1 2 pts. 10,634
  5. Avatar for weitzen 75. weitzen Lv 1 2 pts. 10,614
  6. Avatar for isaksson 76. isaksson Lv 1 2 pts. 10,597
  7. Avatar for dbuske 77. dbuske Lv 1 2 pts. 10,523
  8. Avatar for Vincera 78. Vincera Lv 1 2 pts. 10,431
  9. Avatar for uihcv 79. uihcv Lv 1 1 pt. 10,395
  10. Avatar for Tehnologik1 80. Tehnologik1 Lv 1 1 pt. 10,334

Comments