Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,503
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,427
  3. Avatar for Contenders 3. Contenders 37 pts. 11,392
  4. Avatar for Gargleblasters 4. Gargleblasters 21 pts. 11,366
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 11,350
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 11,318
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,305
  8. Avatar for Go Science 8. Go Science 1 pt. 11,247
  9. Avatar for freefolder 9. freefolder 1 pt. 11,069

  1. Avatar for pfirth 71. pfirth Lv 1 2 pts. 10,710
  2. Avatar for Knoblerine 72. Knoblerine Lv 1 2 pts. 10,680
  3. Avatar for AtOneMent 73. AtOneMent Lv 1 2 pts. 10,639
  4. Avatar for Superphosphate 74. Superphosphate Lv 1 2 pts. 10,634
  5. Avatar for weitzen 75. weitzen Lv 1 2 pts. 10,614
  6. Avatar for isaksson 76. isaksson Lv 1 2 pts. 10,597
  7. Avatar for dbuske 77. dbuske Lv 1 2 pts. 10,523
  8. Avatar for Vincera 78. Vincera Lv 1 2 pts. 10,431
  9. Avatar for uihcv 79. uihcv Lv 1 1 pt. 10,395
  10. Avatar for Tehnologik1 80. Tehnologik1 Lv 1 1 pt. 10,334

Comments