Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195
  1. Avatar for multaq 101. multaq Lv 1 1 pt. 9,363
  2. Avatar for aspadistra 102. aspadistra Lv 1 1 pt. 9,296
  3. Avatar for lord_t 103. lord_t Lv 1 1 pt. 9,281
  4. Avatar for dahast.de 104. dahast.de Lv 1 1 pt. 9,263
  5. Avatar for Tac1 105. Tac1 Lv 1 1 pt. 9,257
  6. Avatar for kludbrook 106. kludbrook Lv 1 1 pt. 9,231
  7. Avatar for allmy 107. allmy Lv 1 1 pt. 9,222
  8. Avatar for Gamercat01 108. Gamercat01 Lv 1 1 pt. 9,218
  9. Avatar for cybcaoyibo 109. cybcaoyibo Lv 1 1 pt. 9,218
  10. Avatar for lamoille 110. lamoille Lv 1 1 pt. 9,196

Comments