Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195
  1. Avatar for Savas 111. Savas Lv 1 1 pt. 9,195
  2. Avatar for alyssajoyh 112. alyssajoyh Lv 1 1 pt. 9,191
  3. Avatar for Giantbluefish 113. Giantbluefish Lv 1 1 pt. 9,180
  4. Avatar for David Windsor 114. David Windsor Lv 1 1 pt. 9,174
  5. Avatar for larry25427 115. larry25427 Lv 1 1 pt. 9,165
  6. Avatar for Sydefecks 116. Sydefecks Lv 1 1 pt. 9,163
  7. Avatar for skracked 117. skracked Lv 1 1 pt. 9,163
  8. Avatar for kashton 118. kashton Lv 1 1 pt. 9,159
  9. Avatar for jamiexq 119. jamiexq Lv 1 1 pt. 9,125
  10. Avatar for arcsign 120. arcsign Lv 1 1 pt. 9,114

Comments