Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195
  1. Avatar for BeImmie 121. BeImmie Lv 1 1 pt. 9,112
  2. Avatar for momadoc 122. momadoc Lv 1 1 pt. 9,054
  3. Avatar for pfirth 123. pfirth Lv 1 1 pt. 9,045
  4. Avatar for Hollinas 124. Hollinas Lv 1 1 pt. 8,750
  5. Avatar for JoelJablonowski 125. JoelJablonowski Lv 1 1 pt. 8,619
  6. Avatar for mirjamvandelft 126. mirjamvandelft Lv 1 1 pt. 8,371
  7. Avatar for 01010011111 127. 01010011111 Lv 1 1 pt. 8,262
  8. Avatar for capacity 128. capacity Lv 1 1 pt. 8,016
  9. Avatar for gottsi 129. gottsi Lv 1 1 pt. 6,940
  10. Avatar for JMStiffler 130. JMStiffler Lv 1 1 pt. 2,903

Comments