Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195
  1. Avatar for Flagg65a 31. Flagg65a Lv 1 29 pts. 10,025
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 27 pts. 10,017
  3. Avatar for Crossed Sticks 33. Crossed Sticks Lv 1 26 pts. 10,015
  4. Avatar for jobo0502 34. jobo0502 Lv 1 25 pts. 10,009
  5. Avatar for toshiue 35. toshiue Lv 1 24 pts. 10,007
  6. Avatar for weitzen 36. weitzen Lv 1 23 pts. 9,998
  7. Avatar for diamonddays 37. diamonddays Lv 1 21 pts. 9,985
  8. Avatar for Museka 38. Museka Lv 1 20 pts. 9,977
  9. Avatar for fpc 39. fpc Lv 1 19 pts. 9,976
  10. Avatar for veroxdraco 40. veroxdraco Lv 1 18 pts. 9,976

Comments