Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195
  1. Avatar for dbuske 51. dbuske Lv 1 10 pts. 9,900
  2. Avatar for YeshuaLives 52. YeshuaLives Lv 1 10 pts. 9,892
  3. Avatar for MicElephant 53. MicElephant Lv 1 9 pts. 9,891
  4. Avatar for justjustin 54. justjustin Lv 1 9 pts. 9,888
  5. Avatar for Vinara 55. Vinara Lv 1 8 pts. 9,860
  6. Avatar for KingLear 56. KingLear Lv 1 8 pts. 9,858
  7. Avatar for rezaefar 57. rezaefar Lv 1 7 pts. 9,857
  8. Avatar for altejoh 58. altejoh Lv 1 7 pts. 9,853
  9. Avatar for tarimo 59. tarimo Lv 1 6 pts. 9,849
  10. Avatar for manu8170 60. manu8170 Lv 1 6 pts. 9,831

Comments