Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195

  1. Avatar for alcor29 61. alcor29 Lv 1 6 pts. 9,825
  2. Avatar for Glen B 62. Glen B Lv 1 5 pts. 9,820
  3. Avatar for DoctorSockrates 63. DoctorSockrates Lv 1 5 pts. 9,814
  4. Avatar for alwen 64. alwen Lv 1 5 pts. 9,803
  5. Avatar for joaniegirl 65. joaniegirl Lv 1 4 pts. 9,785
  6. Avatar for silent gene 66. silent gene Lv 1 4 pts. 9,778
  7. Avatar for frostschutz 67. frostschutz Lv 1 4 pts. 9,776
  8. Avatar for sciencewalker 68. sciencewalker Lv 1 4 pts. 9,768
  9. Avatar for 181818 69. 181818 Lv 1 3 pts. 9,755
  10. Avatar for SouperGenious 70. SouperGenious Lv 1 3 pts. 9,749

Comments