Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195

  1. Avatar for izzgood 81. izzgood Lv 1 2 pts. 9,633
  2. Avatar for tela 82. tela Lv 1 1 pt. 9,633
  3. Avatar for Arne Heessels 83. Arne Heessels Lv 1 1 pt. 9,608
  4. Avatar for JasperD 84. JasperD Lv 1 1 pt. 9,606
  5. Avatar for Psych0Active 85. Psych0Active Lv 1 1 pt. 9,598
  6. Avatar for versat82 86. versat82 Lv 1 1 pt. 9,583
  7. Avatar for cherry39 87. cherry39 Lv 1 1 pt. 9,572
  8. Avatar for jausmh 88. jausmh Lv 1 1 pt. 9,571
  9. Avatar for Altercomp 89. Altercomp Lv 1 1 pt. 9,522
  10. Avatar for mitarcher 90. mitarcher Lv 1 1 pt. 9,483

Comments