Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,182
  2. Avatar for Contenders 2. Contenders 71 pts. 10,153
  3. Avatar for Go Science 3. Go Science 49 pts. 10,143
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,137
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,102
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 10,099
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 10,066
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,059
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,044
  10. Avatar for Team China 10. Team China 2 pts. 9,740

  1. Avatar for Tehnologik1 91. Tehnologik1 Lv 1 1 pt. 9,477
  2. Avatar for rabamino12358 92. rabamino12358 Lv 1 1 pt. 9,474
  3. Avatar for ourtown 93. ourtown Lv 1 1 pt. 9,467
  4. Avatar for boondog 94. boondog Lv 1 1 pt. 9,427
  5. Avatar for Kit Cosby 96. Kit Cosby Lv 1 1 pt. 9,401
  6. Avatar for NotJim99 97. NotJim99 Lv 1 1 pt. 9,390
  7. Avatar for rinze 98. rinze Lv 1 1 pt. 9,389
  8. Avatar for Deleted player 99. Deleted player pts. 9,378
  9. Avatar for Knoblerine 100. Knoblerine Lv 1 1 pt. 9,366

Comments