Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,182
  2. Avatar for Contenders 2. Contenders 71 pts. 10,153
  3. Avatar for Go Science 3. Go Science 49 pts. 10,143
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,137
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,102
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 10,099
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 10,066
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,059
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,044
  10. Avatar for Team China 10. Team China 2 pts. 9,740
  1. Avatar for Kevin76 71. Kevin76 Lv 1 3 pts. 9,740
  2. Avatar for Sci1217 72. Sci1217 Lv 1 3 pts. 9,733
  3. Avatar for Merf 73. Merf Lv 1 3 pts. 9,723
  4. Avatar for Jesse Pinkman 74. Jesse Pinkman Lv 1 2 pts. 9,700
  5. Avatar for ManVsYard 75. ManVsYard Lv 1 2 pts. 9,699
  6. Avatar for Marvelz 76. Marvelz Lv 1 2 pts. 9,695
  7. Avatar for katling 77. katling Lv 1 2 pts. 9,689
  8. Avatar for anthion 78. anthion Lv 1 2 pts. 9,686
  9. Avatar for ViJay7019 79. ViJay7019 Lv 1 2 pts. 9,685
  10. Avatar for leehaggis 80. leehaggis Lv 1 2 pts. 9,668

Comments