Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321
  1. Avatar for rinze 91. rinze Lv 1 1 pt. 9,086
  2. Avatar for Altercomp 92. Altercomp Lv 1 1 pt. 9,063
  3. Avatar for boondog 93. boondog Lv 1 1 pt. 9,059
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 1 pt. 9,049
  5. Avatar for dbuske 95. dbuske Lv 1 1 pt. 9,032
  6. Avatar for 181818 96. 181818 Lv 1 1 pt. 9,019
  7. Avatar for Flagg65a 97. Flagg65a Lv 1 1 pt. 9,002
  8. Avatar for jamiexq 98. jamiexq Lv 1 1 pt. 8,980
  9. Avatar for Anamfija 99. Anamfija Lv 1 1 pt. 8,952
  10. Avatar for roman madala 100. roman madala Lv 1 1 pt. 8,943

Comments