Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,371
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 10,273
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,240
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 30 pts. 10,180
  5. Avatar for Contenders 5. Contenders 19 pts. 10,171
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,134
  7. Avatar for Go Science 7. Go Science 7 pts. 10,122
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 10,100
  9. Avatar for HMT heritage 9. HMT heritage 2 pts. 9,930
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,603
  1. Avatar for rinze 91. rinze Lv 1 1 pt. 9,086
  2. Avatar for Altercomp 92. Altercomp Lv 1 1 pt. 9,063
  3. Avatar for boondog 93. boondog Lv 1 1 pt. 9,059
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 1 pt. 9,049
  5. Avatar for dbuske 95. dbuske Lv 1 1 pt. 9,032
  6. Avatar for 181818 96. 181818 Lv 1 1 pt. 9,019
  7. Avatar for Flagg65a 97. Flagg65a Lv 1 1 pt. 9,002
  8. Avatar for jamiexq 98. jamiexq Lv 1 1 pt. 8,980
  9. Avatar for Anamfija 99. Anamfija Lv 1 1 pt. 8,952
  10. Avatar for roman madala 100. roman madala Lv 1 1 pt. 8,943

Comments