Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,371
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 10,273
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,240
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 30 pts. 10,180
  5. Avatar for Contenders 5. Contenders 19 pts. 10,171
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,134
  7. Avatar for Go Science 7. Go Science 7 pts. 10,122
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 10,100
  9. Avatar for HMT heritage 9. HMT heritage 2 pts. 9,930
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,603
  1. Avatar for alyssa_d 111. alyssa_d Lv 1 1 pt. 8,659
  2. Avatar for NotJim99 112. NotJim99 Lv 1 1 pt. 8,657
  3. Avatar for Giantbluefish 113. Giantbluefish Lv 1 1 pt. 8,605
  4. Avatar for Inkedhands 114. Inkedhands Lv 1 1 pt. 8,535
  5. Avatar for mollyfoldit 115. mollyfoldit Lv 1 1 pt. 8,460
  6. Avatar for mirjamvandelft 116. mirjamvandelft Lv 1 1 pt. 8,422
  7. Avatar for doctaven 117. doctaven Lv 1 1 pt. 8,321
  8. Avatar for Gahmeir 118. Gahmeir Lv 1 1 pt. 8,315
  9. Avatar for KyleSowder 119. KyleSowder Lv 1 1 pt. 8,048
  10. Avatar for Ricardo Oliveira 120. Ricardo Oliveira Lv 1 1 pt. 8,027

Comments