Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,371
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 10,273
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,240
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 30 pts. 10,180
  5. Avatar for Contenders 5. Contenders 19 pts. 10,171
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,134
  7. Avatar for Go Science 7. Go Science 7 pts. 10,122
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 10,100
  9. Avatar for HMT heritage 9. HMT heritage 2 pts. 9,930
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,603

  1. Avatar for metafolder 121. metafolder Lv 1 1 pt. 7,843
  2. Avatar for Marvelz 122. Marvelz Lv 1 1 pt. 7,829
  3. Avatar for 01010011111 123. 01010011111 Lv 1 1 pt. 7,552
  4. Avatar for JMStiffler 124. JMStiffler Lv 1 1 pt. 7,061
  5. Avatar for scrappysheikh 125. scrappysheikh Lv 1 1 pt. 6,533
  6. Avatar for dettingen 126. dettingen Lv 1 1 pt. 6,482
  7. Avatar for west.elsdon 127. west.elsdon Lv 1 1 pt. 6,482
  8. Avatar for JellyJump 128. JellyJump Lv 1 1 pt. 6,482
  9. Avatar for Irvone 129. Irvone Lv 1 1 pt. 6,482
  10. Avatar for rmoretti 130. rmoretti Lv 1 1 pt. 6,482

Comments