Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for leehaggis 101. leehaggis Lv 1 1 pt. 9,510
  2. Avatar for Edder 102. Edder Lv 1 1 pt. 9,407
  3. Avatar for QuantumDeveloper 103. QuantumDeveloper Lv 1 1 pt. 9,396
  4. Avatar for multaq 104. multaq Lv 1 1 pt. 9,393
  5. Avatar for laakko 105. laakko Lv 1 1 pt. 9,379
  6. Avatar for antibot215 106. antibot215 Lv 1 1 pt. 9,378
  7. Avatar for momadoc 107. momadoc Lv 1 1 pt. 9,371
  8. Avatar for Viperx99 108. Viperx99 Lv 1 1 pt. 9,305
  9. Avatar for ivalnic 109. ivalnic Lv 1 1 pt. 9,288
  10. Avatar for PolinaJefferson 110. PolinaJefferson Lv 1 1 pt. 9,284

Comments