Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for khendarg 131. khendarg Lv 1 1 pt. 7,207
  2. Avatar for rmoretti 132. rmoretti Lv 1 1 pt. 5,966
  3. Avatar for liamfratturo 133. liamfratturo Lv 1 1 pt. 4,734
  4. Avatar for Hollinas 134. Hollinas Lv 1 1 pt. 4,734
  5. Avatar for Abdilradov Madiyar 135. Abdilradov Madiyar Lv 1 1 pt. 4,734
  6. Avatar for Aranza L 136. Aranza L Lv 1 1 pt. 4,734
  7. Avatar for kcoleman 137. kcoleman Lv 1 1 pt. 4,734
  8. Avatar for Sugaroid 138. Sugaroid Lv 1 1 pt. 4,734
  9. Avatar for picollo 139. picollo Lv 1 1 pt. 4,734

Comments