Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for johnmitch 11. johnmitch Lv 1 69 pts. 10,548
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 67 pts. 10,535
  3. Avatar for ReallyRatherDumb 13. ReallyRatherDumb Lv 1 64 pts. 10,534
  4. Avatar for tyler0911 14. tyler0911 Lv 1 61 pts. 10,530
  5. Avatar for Aubade01 15. Aubade01 Lv 1 59 pts. 10,522
  6. Avatar for Deleted player 16. Deleted player pts. 10,518
  7. Avatar for reefyrob 17. reefyrob Lv 1 55 pts. 10,511
  8. Avatar for O Seki To 18. O Seki To Lv 1 52 pts. 10,505
  9. Avatar for crpainter 19. crpainter Lv 1 50 pts. 10,501
  10. Avatar for TastyMunchies 20. TastyMunchies Lv 1 48 pts. 10,496

Comments