Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 46 pts. 10,452
  2. Avatar for frood66 22. frood66 Lv 1 44 pts. 10,450
  3. Avatar for pvc78 23. pvc78 Lv 1 42 pts. 10,445
  4. Avatar for robgee 24. robgee Lv 1 41 pts. 10,425
  5. Avatar for fpc 25. fpc Lv 1 39 pts. 10,421
  6. Avatar for nicobul 26. nicobul Lv 1 37 pts. 10,413
  7. Avatar for georg137 27. georg137 Lv 1 36 pts. 10,406
  8. Avatar for Blipperman 28. Blipperman Lv 1 34 pts. 10,361
  9. Avatar for jausmh 29. jausmh Lv 1 33 pts. 10,349
  10. Avatar for Flagg65a 30. Flagg65a Lv 1 31 pts. 10,345

Comments