Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for cbwest 31. cbwest Lv 1 30 pts. 10,320
  2. Avatar for Amphimixus 32. Amphimixus Lv 1 29 pts. 10,297
  3. Avatar for Vinara 33. Vinara Lv 1 27 pts. 10,286
  4. Avatar for joremen 34. joremen Lv 1 26 pts. 10,278
  5. Avatar for isaksson 35. isaksson Lv 1 25 pts. 10,276
  6. Avatar for diamonddays 36. diamonddays Lv 1 24 pts. 10,275
  7. Avatar for Marvelz 37. Marvelz Lv 1 23 pts. 10,274
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 21 pts. 10,258
  9. Avatar for 181818 39. 181818 Lv 1 20 pts. 10,253
  10. Avatar for Jesse Pinkman 40. Jesse Pinkman Lv 1 20 pts. 10,252

Comments