Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for MicElephant 41. MicElephant Lv 1 19 pts. 10,244
  2. Avatar for katling 42. katling Lv 1 18 pts. 10,243
  3. Avatar for orily1337 43. orily1337 Lv 1 17 pts. 10,229
  4. Avatar for DoctorSockrates 44. DoctorSockrates Lv 1 16 pts. 10,227
  5. Avatar for drumpeter18yrs9yrs 45. drumpeter18yrs9yrs Lv 1 15 pts. 10,212
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 14 pts. 10,194
  7. Avatar for cobaltteal 47. cobaltteal Lv 1 14 pts. 10,190
  8. Avatar for Maerlyn138 48. Maerlyn138 Lv 1 13 pts. 10,184
  9. Avatar for Vincera 49. Vincera Lv 1 12 pts. 10,183
  10. Avatar for Deleted player 50. Deleted player pts. 10,170

Comments