Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for YeshuaLives 51. YeshuaLives Lv 1 11 pts. 10,161
  2. Avatar for silent gene 52. silent gene Lv 1 10 pts. 10,159
  3. Avatar for alwen 53. alwen Lv 1 10 pts. 10,155
  4. Avatar for weitzen 54. weitzen Lv 1 9 pts. 10,148
  5. Avatar for jobo0502 55. jobo0502 Lv 1 9 pts. 10,147
  6. Avatar for heather-1 56. heather-1 Lv 1 8 pts. 10,128
  7. Avatar for Prezzemolo 57. Prezzemolo Lv 1 8 pts. 10,121
  8. Avatar for Crossed Sticks 58. Crossed Sticks Lv 1 7 pts. 10,116
  9. Avatar for Alistair69 59. Alistair69 Lv 1 7 pts. 10,115
  10. Avatar for ViJay7019 60. ViJay7019 Lv 1 7 pts. 10,112

Comments