Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for alcor29 61. alcor29 Lv 1 6 pts. 10,107
  2. Avatar for rezaefar 62. rezaefar Lv 1 6 pts. 10,051
  3. Avatar for phi16 63. phi16 Lv 1 6 pts. 10,032
  4. Avatar for Deleted player 64. Deleted player pts. 10,030
  5. Avatar for ppp6 65. ppp6 Lv 1 5 pts. 10,028
  6. Avatar for vakobo 66. vakobo Lv 1 5 pts. 10,003
  7. Avatar for ourtown 67. ourtown Lv 1 4 pts. 9,966
  8. Avatar for JasperD 68. JasperD Lv 1 4 pts. 9,946
  9. Avatar for drjr 69. drjr Lv 1 4 pts. 9,939
  10. Avatar for pfirth 70. pfirth Lv 1 4 pts. 9,936

Comments