Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for Glen B 71. Glen B Lv 1 3 pts. 9,925
  2. Avatar for hansvandenhof 72. hansvandenhof Lv 1 3 pts. 9,916
  3. Avatar for justjustin 73. justjustin Lv 1 3 pts. 9,915
  4. Avatar for Superphosphate 74. Superphosphate Lv 1 3 pts. 9,912
  5. Avatar for lconor 75. lconor Lv 1 3 pts. 9,904
  6. Avatar for altejoh 76. altejoh Lv 1 2 pts. 9,902
  7. Avatar for fisherlr777 77. fisherlr777 Lv 1 2 pts. 9,845
  8. Avatar for dd-2 78. dd-2 Lv 1 2 pts. 9,843
  9. Avatar for sciencewalker 79. sciencewalker Lv 1 2 pts. 9,833
  10. Avatar for Paulo Roque 80. Paulo Roque Lv 1 2 pts. 9,829

Comments