Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,440
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 10,352
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 10,324
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,298
  5. Avatar for Go Science 5. Go Science 22 pts. 10,172
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,115
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,109
  8. Avatar for Contenders 8. Contenders 5 pts. 9,982
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,743
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 2 pts. 8,794
  1. Avatar for ClassicShyGuy 91. ClassicShyGuy Lv 1 1 pt. 8,637
  2. Avatar for joaniegirl 92. joaniegirl Lv 1 1 pt. 8,614
  3. Avatar for Deleted player 93. Deleted player pts. 8,572
  4. Avatar for kludbrook 94. kludbrook Lv 1 1 pt. 8,572
  5. Avatar for rinze 95. rinze Lv 1 1 pt. 8,500
  6. Avatar for GUANINJIN 96. GUANINJIN Lv 1 1 pt. 8,495
  7. Avatar for SouperGenious 97. SouperGenious Lv 1 1 pt. 8,457
  8. Avatar for Knoblerine 98. Knoblerine Lv 1 1 pt. 8,391
  9. Avatar for JoelJablonowski 99. JoelJablonowski Lv 1 1 pt. 8,371
  10. Avatar for justjustin 100. justjustin Lv 1 1 pt. 8,366

Comments